Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02846.1.g00110.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 380aa    MW: 40607.7 Da    PI: 8.3354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl 14 KGPWSPEEDAKLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                                    79*********************************************97 PP

                 Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     g +T+ E+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++  69 GDFTEKEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                     789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.018966IPR017930Myb domain
SMARTSM007173.1E-131364IPR001005SANT/Myb domain
PfamPF002499.7E-161462IPR001005SANT/Myb domain
CDDcd001672.97E-101662No hitNo description
SMARTSM007173.7E-967115IPR001005SANT/Myb domain
PROSITE profilePS5129416.10367117IPR017930Myb domain
PfamPF002495.1E-1069111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660926.11e-157PREDICTED: uncharacterized protein LOC101760334
SwissprotQ9FKL26e-86MYB36_ARATH; Transcription factor MYB36
TrEMBLK3YT201e-161K3YT20_SETIT; Uncharacterized protein
STRINGSi017415m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number